PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g091700.1
Common NameMTR_3g091700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Nin-like
Protein Properties Length: 262aa    MW: 30601.1 Da    PI: 7.9904
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g091700.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK76.43.4e-24152201352
           RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      ++++++d++k+F+ pi+ AAk+L+v++T LK++CR+++I RWPhRk++sl
  Medtr3g091700.1 152 SSLQFDDIKKHFDVPITMAAKKLNVGVTFLKKRCRELNITRWPHRKLRSL 201
                      689*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.586141223IPR003035RWP-RK domain
PfamPF020422.3E-21154201IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MDFFTQPEIT QSFNWFCNVQ PQQNDTDKIM GIAPFDDFFE FDWATQFSYQ SNHFYMNDFD  60
DLENFNFDFN LPHLDQNNFE VDKKPLNVVL PELGHYNHKG ETVGYVEASV KTESGFVSFV  120
KKENEWENQE LSSLVPLALQ SSSTSIIRKR SSSLQFDDIK KHFDVPITMA AKKLNVGVTF  180
LKKRCRELNI TRWPHRKLRS LMLLIDNLKD KGLTKEVAML EKQKKMLEKL PGMHLNDEIK  240
KLRQACFKAN YKNRKLIALC P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR9566190.0CR956619.7 M.truncatula DNA sequence from clone MTH2-65F22 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003602270.10.0RWP-RK domain protein
TrEMBLG7J7G00.0G7J7G0_MEDTR; RWP-RK domain protein
STRINGGLYMA06G13540.22e-73(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.11e-32RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]